due to industry policies mastercard payments are disabled — all other credit cards and payment options are available

0

Tesmorelin

Tesmorelin is a synthetic peptide analog of growth hormone-releasing hormone (GHRH) and is commonly utilized in biochemical and molecular research involving peptide–receptor interactions and signaling pathway analysis. In controlled laboratory settings, it is studied for its interaction with growth hormone-releasing hormone receptors (GHRH-R) and its role in intracellular signaling mechanisms within endocrine research models under defined in vitro conditions. This material is supplied in lyophilized powder form and is intended strictly for in vitro research and analytical applications.

Select Weight

Select Amount

-
+
$47.00

Order More, Save More

Free Shipping on All Orders $175+

Product Usage: For Research Use Only – Not for Human or Veterinary Use
This product is not a drug, food, cosmetic, or dietary supplement and has not been evaluated by the FDA. It is strictly intended for in vitro research by qualified professionals. Any use in humans or animals is strictly prohibited and may violate federal, state, or local laws, including the Federal Food, Drug, and Cosmetic Act. No therapeutic or diagnostic application is implied or permitted. The purchaser assumes all responsibility for compliance with applicable regulations. By purchasing this product, the buyer represents and warrants that it will be used solely for in vitro research purposes and acknowledges that Pure Health Peptides maintains internal policies intended to support research-use-only sales.

Description

Product Name:
Tesmorelin (Growth Hormone-Releasing Hormone Analog)
Chemical Information:
  • Molecular Formula: C223H370N72O69S
  • Molecular Weight: 5195.9 g/mol
  • Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
  • Molecular Structure:
Molecular Structure
Product Description:
Tesmorelin is a synthetic peptide analog of growth hormone-releasing hormone (GHRH) and is commonly utilized in biochemical and molecular research involving peptide–receptor interactions and signaling pathway analysis. In controlled laboratory settings, it is studied for its interaction with growth hormone-releasing hormone receptors (GHRH-R) and its role in intracellular signaling mechanisms within endocrine research models under defined in vitro conditions. This material is supplied in lyophilized powder form and is intended strictly for in vitro research and analytical applications.
Research Applications:
Tesmorelin is utilized in controlled research environments to support investigation of:
  • Growth hormone-releasing hormone receptor (GHRH-R) binding and signaling pathway analysis in isolated cell-based or cell-free in vitro assay systems
  • Peptide–receptor interaction dynamics in endocrine signaling models
  • Intracellular signaling cascade evaluation associated with peptide ligands
  • Structure-function relationships of GHRH-derived peptide analogs
  • Stability, degradation, and analytical profiling in assay-based systems

All research applications are conducted in non-human, non-clinical experimental settings.

Storage and Handling:
  • Store lyophilized material at −20°C (−4°F)
  • After reconstitution, store at 2–8°C (36–46°F) and use promptly
  • Avoid repeated freeze-thaw cycles
  • Maintain aseptic laboratory handling procedures
Product Specifications:
  • Purity: ≥99% (HPLC Certified)
  • Appearance: Lyophilized white powder
  • Solubility: Soluble in suitable laboratory agents
Compliance Notice:
Tesmorelin is FOR RESEARCH USE ONLY. It is not intended for human or veterinary use. This product has not been evaluated by the FDA. Misuse of this product is strictly prohibited and may violate federal, state, or local laws. By purchasing this product, buyer represents and warrants that it will be used only for in vitro research purposes.
Group 3330 1024x716 1

Certificate of Analysis

At Pure Health Peptides, transparency is key. Every batch is third-party tested in the USA, with Certificates of Analysis (COAs) readily available for verification, giving researchers confidence in their work.

related products

subscribe to newsletter

Be the first to know about new products & special
offers from Pure Health Peptides!

    Your Cart
    Your cart is emptyReturn to Shop

    Welcome to

    Pure Health Peptides

    All products sold by Pure Health Peptides LLC are intended for laboratory and research purposes only. They are not for human consumption, veterinary use, or medical applications. You must be 21 years or older to purchase. Misuse of these products is strictly prohibited.

    You must be 21 or older to access this site.