Product Name:

Tesmorelin (Growth Hormone-Releasing Hormone Analog)

Chemical Information:

• Molecular Formula: C₂₂₃H₃₇₀N₇₂O₆₉S
• Molecular Weight: 5195.9 g/mol
• Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
• Molecular Structure:

Description:

Tesmorelin is a synthetic peptide analog of growth hormone-releasing hormone (GHRH) that has been extensively studied for its ability to stimulate the release of growth hormone (GH). By mimicking the natural GHRH, Tesmorelin promotes anabolic processes and has been widely used in research related to metabolism, fat distribution, and cellular regeneration. Tesamorelin is provided in lyophilized powder form for research applications involving growth hormone regulation and metabolic health.

Research Applications:

Tesmorelin is actively researched for its potential to:

• Enhance Growth Hormone Secretion: Investigate its role in stimulating endogenous growth hormone release.
• Support Fat Metabolism: Study its effects on reducing visceral adipose tissue and improving metabolic health.
• Improve Muscle Mass: Explore its potential in increasing lean body mass through anabolic processes.
• Promote Cognitive Function: Research its impact on cognitive health and neuroprotection through GH regulation.

Storage and Handling:

• Store lyophilized powder at -20°C.
• Once reconstituted, store at 2-8°C and use promptly.
• Maintain aseptic techniques during handling to ensure sterility.

Product Specifications:

• Purity: ≥99% (HPLC Certified)
• Appearance: Lyophilized white powder
• Solubility: Soluble in bacteriostatic water

Compliance Notice:

Tesmorelin is FOR RESEARCH USE ONLY. It is not intended for human or veterinary use. This product has not been evaluated by the FDA. Misuse of this product is strictly prohibited and may violate federal, state, or local laws. By purchasing this product, buyer represents and warrants that it will be used only for in vitro research purposes.