Free Shipping for All Order $175+

Tesmorelin

Tesmorelin is a synthetic peptide analog of growth hormone-releasing hormone (GHRH) that has been extensively studied for its ability to stimulate the release of growth hormone (GH). By mimicking the natural GHRH, Tesmorelin promotes anabolic processes and has been widely used in research related to metabolism, fat distribution, and cellular regeneration. Tesmorelin is provided in lyophilized powder form for research applications involving growth hormone regulation and metabolic health.

Select Weight

Select Amount

-
+
$47.00

Order More, Save More

Free Shipping on All Orders $175+

Product Usage:ย For Research Use Only โ€“ Not for Human or Veterinary Use
This product is not a drug, food, cosmetic, or dietary supplement and has not been evaluated by the FDA. It is strictly intended for in vitro research by qualified professionals. Any use in humans or animals is strictly prohibited and may violate federal, state, or local laws, including the Federal Food, Drug, and Cosmetic Act. No therapeutic or diagnostic application is implied or permitted. The purchaser assumes all responsibility for compliance with applicable regulations.

Description

Product Name:
Tesmorelin (Growth Hormone-Releasing Hormone Analog)
Chemical Information:
  • Molecular Formula: C223H370N72O69S
  • Molecular Weight: 5195.9 g/mol
  • Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
  • Molecular Structure:
Molecular Structure
Description:
Tesmorelin is a synthetic peptide analog of growth hormone-releasing hormone (GHRH) that has been extensively studied for its ability to stimulate the release of growth hormone (GH). By mimicking the natural GHRH, Tesmorelin promotes anabolic processes and has been widely used in research related to metabolism, fat distribution, and cellular regeneration. Tesmorelin is provided in lyophilized powder form for research applications involving growth hormone regulation and metabolic health.
Research Applications:
Tesmorelin is actively researched for its potential to:
  • Enhance Growth Hormone Secretion: Investigate its role in stimulating endogenous growth hormone release.
  • Support Fat Metabolism: Study its effects on reducing visceral adipose tissue and improving metabolic health.
  • Improve Muscle Mass: Explore its potential in increasing lean body mass through anabolic processes.
  • Promote Cognitive Function: Research its impact on cognitive health and neuroprotection through GH regulation.
Storage and Handling:
  • Store lyophilized powder at -20ยฐC.
  • Once reconstituted, store at 2-8ยฐC and use promptly.
  • Maintain aseptic techniques during handling to ensure sterility.
Product Specifications:
  • Purity: โ‰ฅ99% (HPLC Certified)
  • Appearance: Lyophilized white powder
  • Solubility: Soluble in bacteriostatic water
Compliance Notice:
Tesmorelin is FOR RESEARCH USE ONLY. It is not intended for human or veterinary use. This product has not been evaluated by the FDA. Misuse of this product is strictly prohibited and may violate federal, state, or local laws. By purchasing this product, buyer represents and warrants that it will be used only for in vitro research purposes.
Group 3330 1024x716 1

Certificate of Analysis

At Pure Health Peptides, transparency is key. Every batch is third-party tested in the USA, with Certificates of Analysis (COAs) readily available for verification, giving researchers confidence in their work.

related products

subscribe to newsletter

Be the first to know about new products & special
offers from Pure Health Peptides!

    Your Cart
    Your cart is emptyReturn to Shop

    Welcome to

    Pure Health Peptides

    All products sold by Pure Health Peptides LLC are intended for laboratory and research purposes only. They are not for human consumption, veterinary use, or medical applications. You must be 21 years or older to purchase. Misuse of these products is strictly prohibited.

    You must be 21 or older to access this site.