First Time Customer? First Time Order? Get your 25% Off [Click Here]

0

PNC-27

PNC-27 is a synthetic peptide consisting of a defined amino acid sequence. It is supplied in lyophilized powder form to support purity and stability in laboratory environments. PNC-27 is intended strictly for controlled in vitro laboratory research by qualified professionals.

Select Weight

Select Amount

-
+
$79.00

Order More, Save More

Free Shipping on All Orders $175+

Product Usage: Not for Human or Veterinary Use

Pure Health Peptides products are supplied to qualified research professionals and institutional users for in vitro laboratory research only. KYC verification is required prior to order fulfillment, and we reserve the right to refuse orders that do not meet buyer qualification criteria. These products are not drugs, foods, cosmetics, diagnostic products, or dietary supplements, have not been evaluated by the FDA, and are not intended for human or animal use. Any such use is prohibited and may violate federal, state, or local law. By purchasing, the buyer represents and warrants that the product will be used solely for in vitro research. The buyer agrees to indemnify, defend, and hold harmless Pure Health Peptides, its officers, employees, and agents from and against any and all claims, damages, losses, liabilities, costs, and expenses (including reasonable attorneys fees) arising out of or relating to the buyer’s use, handling, storage, or disposition of the product in any manner inconsistent with its research-use-only designation or applicable law.

Product Usage: For Research Use Only – Not for Human or Veterinary Use

Pure Health Peptides products are supplied to qualified research professionals and institutional users for in vitro laboratory research only. KYC verification is required prior to order fulfillment, and we reserve the right to refuse orders that do not meet buyer qualification criteria. These products are not drugs, foods, cosmetics, or dietary supplements, have not been evaluated by the FDA, and are not intended for human or animal use. Any such use is prohibited and may violate federal, state, or local law. By purchasing, the buyer represents and warrants that the product will be used solely for in vitro research.

Description

Product Name:
PNC-27
Chemical Information:
  • Molecular Formula: C188H293N53O44S
  • Molecular Weight: 4031.7 g/mol
  • Sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
  • Structure Class: Energy minimized structure of PNC-27
Molecular Structure:
Molecular Structure
Product Description:
PNC-27 is a synthetic peptide consisting of a defined amino acid sequence. It is supplied in lyophilized powder form to support purity and stability in laboratory environments. PNC-27 is intended strictly for controlled in vitro laboratory research by qualified professionals.
Research Applications:
  • Characterization of peptide structural properties in vitro
  • Analysis of peptide stability and degradation profiles
  • Evaluation of physicochemical properties of synthetic peptide compounds
  • Investigation of peptide behavior under controlled laboratory conditions
  • Analytical assessment of peptide consistency and composition
  Storage and Handling:
  • Store lyophilized powder at −20 °C until use
  • After reconstitution, store at 2–8 °C and use promptly
  • Use aseptic techniques during handling and reconstitution

Product Specifications:

  • Purity: ≥99% (HPLC Certified)
  • Appearance: Lyophilized white to off-white powder
  • Solubility: Soluble in suitable laboratory agents
Compliance Notice:
PNC-27 is FOR RESEARCH USE ONLY. It is not intended for human or veterinary use. This product has not been evaluated by the FDA. Misuse of this product is strictly prohibited and may violate federal, state, or local laws. By purchasing this product, buyer represents and warrants that it will be used only for in vitro research purposes
Group 3330 1024x716 1

Certificate of Analysis

At Pure Health Peptides, transparency is key. Every batch is third-party tested in the USA, with Certificates of Analysis (COAs) readily available for verification, giving researchers confidence in their work.

related products

subscribe to newsletter

Be the first to know about new products & special
offers from Pure Health Peptides!

    Your Cart
    Your cart is emptyReturn to Shop

    Welcome to

    Pure Health Peptides

    All products sold by Pure Health Peptides LLC are intended for laboratory and research purposes only. They are not for human consumption, veterinary use, or medical applications. You must be 21 years or older to purchase. Misuse of these products is strictly prohibited.

    You must be 21 or older to access this site.