Research Area:

Metabolics

Product Identifiers:

• Molecular Formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂
• Molecular Weight: 4409.01 g/mol
• Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
• Molecular Structure:

Description:

This is a synthetic metabolic peptide analog supplied in lyophilized powder form for use in qualified laboratory environments. The compound is intended for in vitro and analytical research applications involving metabolic signaling pathways. This material is provided strictly for research use only and has not been evaluated for clinical, therapeutic, or diagnostic use.

Research Applications:

In laboratory research settings, this peptide analog is utilized in controlled experimental systems to support investigation of:

• Metabolic signaling pathway characterization
• Receptor interaction and activation modeling in controlled assay systems
• Structure–function relationship analysis
• Stability, degradation, and binding behavior under experimental conditions
• Comparative evaluation of peptide analog modifications

These research activities are conducted in non-clinical, non-therapeutic contexts.

Specifications:

• Appearance: White to off-white lyophilized powder
• Solubility: Compatible with bacteriostatic water
• Storage: Store at −20 °C or below prior to reconstitution
• Handling: Allow vial and diluent to reach room temperature before reconstitution
• Stability: Stable under recommended storage and handling conditions

Compliance Notice:

This compound is FOR RESEARCH USE ONLY and it has not been evaluated by the FDA. It is not intended for human or veterinary use. This product is not approved for diagnostic, therapeutic, or clinical purposes. Misuse of this material may violate federal, state, or local laws. By purchasing this product, buyer represents and warrants that it will be used only for in vitro research purposes.