master card not available — error being corrected — thank you for your patience —

0

GLP-1 (C)

This is a synthetic peptide analog supplied in lyophilized powder form for use in qualified laboratory environments. The compound is intended for in vitro and analytical research applications involving peptide interaction and assay-based systems under controlled experimental conditions. This material is provided strictly for research use only and has not been evaluated for clinical, therapeutic, or diagnostic use.

Select Weight

Select Amount

-
+
$115.00

Order More, Save More

Free Shipping on All Orders $175+

Product Usage: For Research Use Only – Not for Human or Veterinary Use
This product is not a drug, food, cosmetic, or dietary supplement and has not been evaluated by the FDA. It is strictly intended for in vitro research by qualified professionals. Any use in humans or animals is strictly prohibited and may violate federal, state, or local laws, including the Federal Food, Drug, and Cosmetic Act. No therapeutic or diagnostic application is implied or permitted. The purchaser assumes all responsibility for compliance with applicable regulations. By purchasing this product, the buyer represents and warrants that it will be used solely for in vitro research purposes and acknowledges that Pure Health Peptides maintains internal policies intended to support research-use-only sales.

Description

Research Area:
Metabolics
Product Identifiers:
  • Molecular Formula: C194H312N54O59S2
  • Molecular Weight: 4409.01 g/mol
  • Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
  • Molecular Structure:
Molecular Structure
Description:
This is a synthetic peptide analog supplied in lyophilized powder form for use in qualified laboratory environments. The compound is intended for in vitro and analytical research applications involving peptide interaction and assay-based systems under controlled experimental conditions. This material is provided strictly for research use only and has not been evaluated for clinical, therapeutic, or diagnostic use.
Research Applications:
In laboratory research settings, this peptide analog is utilized in controlled experimental systems to support investigation of:
  • Peptide interaction characterization in defined assay systems
  • Receptor binding interaction modeling in controlled experimental environments
  • Structure–property relationship analysis
  • Stability, degradation, and binding behavior under experimental conditions
  • Comparative evaluation of peptide analog modifications

These research activities are conducted in non-clinical, non-therapeutic contexts.

Specifications:
  • Appearance: White to off-white lyophilized powder
  • Solubility: Soluble in suitable laboratory agents
  • Storage: Store at −20 °C or below prior to reconstitution
  • Handling: Allow vial and diluent to reach room temperature before reconstitution
  • Stability: Stable under recommended storage and handling conditions
Compliance Notice:
This compound is FOR RESEARCH USE ONLY and it has not been evaluated by the FDA. It is not intended for human or veterinary use. This product is not approved for diagnostic, therapeutic, or clinical purposes. Misuse of this material may violate federal, state, or local laws. By purchasing this product, buyer represents and warrants that it will be used only for in vitro research purposes.
Group 3330 1024x716 1

Certificate of Analysis

At Pure Health Peptides, transparency is key. Every batch is third-party tested in the USA, with Certificates of Analysis (COAs) readily available for verification, giving researchers confidence in their work.

related products

subscribe to newsletter

Be the first to know about new products & special
offers from Pure Health Peptides!

    Your Cart
    Your cart is emptyReturn to Shop

    Welcome to

    Pure Health Peptides

    All products sold by Pure Health Peptides LLC are intended for laboratory and research purposes only. They are not for human consumption, veterinary use, or medical applications. You must be 21 years or older to purchase. Misuse of these products is strictly prohibited.

    You must be 21 or older to access this site.