Free Shipping for All Order $175+

GLP-1 (C)

GLP-1 (C) is a synthetic peptide analog provided in lyophilized powder form for use in qualified laboratory environments. It is commonly used in in vitro systems to explore structural stability, receptor interaction modeling, and peptide pathway evaluation in controlled, non-clinical research settings.

Select Weight

Select Amount

-
+
$115.00

Order More, Save More

Free Shipping on All Orders $175+

Product Usage: For Research Use Only – Not for Human or Veterinary Use
This product is not a drug, food, cosmetic, or dietary supplement and has not been evaluated by the FDA. It is strictly intended for in vitro research by qualified professionals. Any use in humans or animals is strictly prohibited and may violate federal, state, or local laws, including the Federal Food, Drug, and Cosmetic Act. No therapeutic or diagnostic application is implied or permitted. The purchaser assumes all responsibility for compliance with applicable regulations.

Description

Product Name:
GLP-1 (C)
Chemical Information:
  • Molecular Formula: C194H312N54O59S2
  • Molecular Weight: 4409.01 g/mol
  • Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
  • Molecular Structure:
Molecular Structure
Description:
GLP-1 (C) is a synthetic peptide analog provided in lyophilized powder form for exclusive use in qualified laboratory environments. It is intended for in vitro systems to explore structural stability, receptor interaction modeling, and peptide pathway evaluation under controlled, non-clinical research settings.
Research Applications:
GLP-1 (C) is currently being studied in laboratory models to support:
  • Structural investigation of peptide-receptor affinity
  • Receptor activation modeling in non-human biological systems
  • Analog characterization under simulated metabolic pathway conditions
  • General evaluation of synthetic peptide behavior in assay environments
Storage and Handling:
  • Store lyophilized powder at -20°C
  • Once reconstituted, store at 2–8°C and use promptly
  • Maintain aseptic techniques during handling to ensure sterility
Product Specifications:
  • Purity: ≥99% (HPLC Verified)
  • Appearance: Lyophilized white powder
  • Solubility: Soluble in bacteriostatic water
Compliance Notice:
GLP-1 (C) is FOR RESEARCH USE ONLY. This product has not been evaluated by the FDA. It is not intended for human or veterinary use. This product is not approved for diagnostic, therapeutic, or clinical purposes. Misuse of this material may violate federal, state, or local laws. By purchasing this product, buyer represents and warrants that it will be used only for in vitro research purposes.

Certificate of Analysis

At Pure Health Peptides, transparency is key. Every batch is third-party tested in the USA, with Certificates of Analysis (COAs) readily available for verification, giving researchers confidence in their work.

related products

subscribe to newsletter

Be the first to know about new products & special
offers from Pure Health Peptides!

    Your Cart
    Your cart is emptyReturn to Shop

    Welcome to

    Pure Health Peptides

    All products sold by Pure Health Peptides LLC are intended for laboratory and research purposes only. They are not for human consumption, veterinary use, or medical applications. You must be 21 years or older to purchase. By using this site, you agree to comply with all applicable laws and regulations regarding these products. Misuse of these products is strictly prohibited.

    You must be 21 or older to access this site.