FOXO4-DRI
FOXO4-DRI (FOXO4 D-Retro-Inverso) is a synthetic peptide engineered in a D-retro-inverso configuration based on a defined peptide sequence. The retro-inverso design and D-residue composition are utilized in research to examine peptide stability and interaction characteristics in vitro. Supplied as a lyophilized powder, FOXO4-DRI is intended strictly for controlled laboratory research.
Free Shipping on All Orders $175+
Product Usage: For Research Use Only – Not for Human or Veterinary Use
This product is not a drug, food, cosmetic, or dietary supplement and has not been evaluated by the FDA. It is strictly intended for in vitro research by qualified professionals. Any use in humans or animals is strictly prohibited and may violate federal, state, or local laws, including the Federal Food, Drug, and Cosmetic Act. No therapeutic or diagnostic application is implied or permitted. The purchaser assumes all responsibility for compliance with applicable regulations. By purchasing this product, the buyer represents and warrants that it will be used solely for in vitro research purposes and acknowledges that Pure Health Peptides maintains internal policies intended to support research-use-only sales.
Description
Product Name:
FOXO4-DRI (FOXO4 D-Retro-Inverso)Chemical Information:
- Molecular Formula: C228H388N86O64
- Molecular Weight: ~5358 g/mol
- Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP (D-amino acids; retro-inverso)
- Structure Class: Synthetic peptide (D-retro-inverso configuration)
Molecular Structure:
Product Description:
FOXO4-DRI (FOXO4 D-Retro-Inverso) is a synthetic peptide engineered in a D-retro-inverso configuration based on a defined peptide sequence. The retro-inverso design and D-residue composition are utilized in research to examine peptide stability and interaction characteristics in vitro. Supplied as a lyophilized powder, FOXO4-DRI is intended strictly for controlled laboratory research.Research Applications:
FOXO4-DRI is utilized in controlled laboratory research settings for applications such as:
- Evaluation of D-retro-inverso peptide behavior in stability and interaction assays
- Investigation of peptide–protein binding interactions in defined assay systems
- Comparative analysis of L- and D-configured peptide structures under controlled conditions
- Development of in vitro assay systems for studying peptide interaction characteristics
Storage and Handling:
- Store lyophilized powder at −20 °C until use
- Once reconstituted, store at 2–8 °C and use promptly
- Maintain aseptic technique during handling
Product Specifications:
- Purity: ≥99% (HPLC/LC-MS Verified)
- Appearance: Lyophilized white powder
- Solubility: Soluble in suitable laboratory agents
Compliance Notice:
FOXO4-DRI is FOR RESEARCH USE ONLY. It is not intended for human or veterinary use. This product has not been evaluated by the FDA. Misuse of this product is strictly prohibited and may violate federal, state, or local laws. By purchasing this product, buyer represents and warrants that it will be used only for in vitro research purposes.
Certificate of Analysis
At Pure Health Peptides, transparency is key. Every batch is third-party tested in the USA, with Certificates of Analysis (COAs) readily available for verification, giving researchers confidence in their work.
related products
subscribe to newsletter
Be the first to know about new products & special
offers from Pure Health Peptides!