Product Name:

FOXO4-DRI (FOXO4 D-Retro-Inverso)

Chemical Information:

• Molecular Formula: C₂₂₈H₃₈₈N₈₆O₆₄
• Molecular Weight: ~5358 g/mol
• Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP (D-amino acids; retro-inverso)
• Structure Class: Synthetic peptide (D-retro-inverso configuration)

Molecular Structure:

Description:

FOXO4-DRI (FOXO4 D-Retro-Inverso) is a synthetic peptide engineered in a D-retro-inverso configuration based on a FOXO4 interaction domain. The retro-inverso design and D-residue composition are used in research to study peptide stability and target-interaction modeling in vitro. Supplied as a lyophilized powder, FOXO4-DRI is intended strictly for controlled laboratory research.

Research Applications:

FOXO4-DRI is used in controlled research protocols addressing topics such as:

• Evaluation of D-retro-inverso peptide behavior in stability and interaction assays
• In-vitro modeling of peptide–protein interaction disruption
• Structure–activity comparisons between L- and D-configured research peptides
• Assay development for cellular pathway interrogation under controlled conditions

Storage and Handling:

• Store lyophilized powder at −20 °C until use
• Once reconstituted, store at 2–8 °C and use promptly
• Maintain aseptic technique during handling

Product Specifications:

• Purity: ≥99% (HPLC/LC-MS Verified)
• Appearance: Lyophilized white powder
• Solubility: Soluble in bacteriostatic water

Compliance Notice:

FOXO4-DRI is FOR RESEARCH USE ONLY. It is not intended for human or veterinary use. This product has not been evaluated by the FDA. Any misuse may violate federal, state, or local laws. By purchasing this product, the buyer represents and warrants that it will be used only for in vitro research purposes.