Free Shipping for All Order $175+

FOXO4-DRI

FOXO4-DRI is a synthetic peptide engineered in a D-retro-inverso configuration based on a FOXO4 interaction domain. The retro-inverso design and D-residue composition are used in research to study peptide stability and target-interaction modeling in vitro. Supplied as a lyophilized powder, FOXO4-DRI is intended strictly for controlled laboratory research.

Select Weight

Select Amount

-
+
$99.00

Order More, Save More

Free Shipping on All Orders $175+

Product Usage:ย For Research Use Only โ€“ Not for Human or Veterinary Use
This product is not a drug, food, cosmetic, or dietary supplement and has not been evaluated by the FDA. It is strictly intended for in vitro research by qualified professionals. Any use in humans or animals is strictly prohibited and may violate federal, state, or local laws, including the Federal Food, Drug, and Cosmetic Act. No therapeutic or diagnostic application is implied or permitted. The purchaser assumes all responsibility for compliance with applicable regulations.

Description

Product Name:
FOXO4-DRI (FOXO4 D-Retro-Inverso)
Chemical Information:
  • Molecular Formula: C228H388N86O64
  • Molecular Weight: ~5358 g/mol
  • Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP (D-amino acids; retro-inverso)
  • Structure Class: Synthetic peptide (D-retro-inverso configuration)
Molecular Structure:
Molecular Structure
Description:
FOXO4-DRI (FOXO4 D-Retro-Inverso) is a synthetic peptide engineered in a D-retro-inverso configuration based on a FOXO4 interaction domain. The retro-inverso design and D-residue composition are used in research to study peptide stability and target-interaction modeling in vitro. Supplied as a lyophilized powder, FOXO4-DRI is intended strictly for controlled laboratory research.
Research Applications:
FOXO4-DRI is used in controlled research protocols addressing topics such as:
  • Evaluation of D-retro-inverso peptide behavior in stability and interaction assays
  • In-vitro modeling of peptideโ€“protein interaction disruption
  • Structureโ€“activity comparisons between L- and D-configured research peptides
  • Assay development for cellular pathway interrogation under controlled conditions
Storage and Handling:
  • Store lyophilized powder at โˆ’20 ยฐC until use
  • Once reconstituted, store at 2โ€“8 ยฐC and use promptly
  • Maintain aseptic technique during handling
Product Specifications:
  • Purity: โ‰ฅ99% (HPLC/LC-MS Verified)
  • Appearance: Lyophilized white powder
  • Solubility: Soluble in bacteriostatic water
Compliance Notice:
FOXO4-DRI is FOR RESEARCH USE ONLY. It is not intended for human or veterinary use. This product has not been evaluated by the FDA. Any misuse may violate federal, state, or local laws. By purchasing this product, the buyer represents and warrants that it will be used only for in vitro research purposes.
Group 3330 1024x716 1

Certificate of Analysis

At Pure Health Peptides, transparency is key. Every batch is third-party tested in the USA, with Certificates of Analysis (COAs) readily available for verification, giving researchers confidence in their work.

related products

subscribe to newsletter

Be the first to know about new products & special
offers from Pure Health Peptides!

    Your Cart
    Your cart is emptyReturn to Shop

    Welcome to

    Pure Health Peptides

    All products sold by Pure Health Peptides LLC are intended for laboratory and research purposes only. They are not for human consumption, veterinary use, or medical applications. You must be 21 years or older to purchase. Misuse of these products is strictly prohibited.

    You must be 21 or older to access this site.