Free Shipping for All Order $175+

Tesamorelin

Tesamorelin is a synthetic peptide analog of growth hormone-releasing hormone (GHRH) that has been extensively studied for its ability to stimulate the release of growth hormone (GH). By mimicking the natural GHRH, Tesamorelin promotes anabolic processes and has been widely used in research related to metabolism, fat distribution, and cellular regeneration. Tesamorelin is provided in lyophilized powder form for research applications involving growth hormone regulation and metabolic health.

Select Weight

Select Amount

-
+
$47.00

Order More, Save More

Free Shipping on All Orders $175+

Product Usage: For Research Use Only – Not for Human or Veterinary Use
This product is intended strictly for in vitro research and laboratory experimentation by qualified professionals. It is not a drug, food, cosmetic, or dietary supplement and has not been evaluated by the FDA. It is not intended to diagnose, treat, cure, or prevent any disease. The bodily introduction of this product into humans or animals is strictly prohibited by law. Any misuse, misbranding, or mislabeling of this product is a violation of federal regulations.

Description

Product Name:
Tesamorelin (Growth Hormone-Releasing Hormone Analog)
Chemical Information:
  • Molecular Formula: C223H370N72O69S
  • Molecular Weight: 5195.9 g/mol
  • Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Molecular Structure:
Molecular Structure
Description:
Tesamorelin is a synthetic peptide analog of growth hormone-releasing hormone (GHRH) that has been extensively studied for its ability to stimulate the release of growth hormone (GH). By mimicking the natural GHRH, Tesamorelin promotes anabolic processes and has been widely used in research related to metabolism, fat distribution, and cellular regeneration. Tesamorelin is provided in lyophilized powder form for research applications involving growth hormone regulation and metabolic health.
Research Applications
Tesamorelin is actively researched for its potential to:
  • Enhance Growth Hormone Secretion: Investigate its role in stimulating endogenous growth hormone release.
  • Support Fat Metabolism: Study its effects on reducing visceral adipose tissue and improving metabolic health.
  • Improve Muscle Mass: Explore its potential in increasing lean body mass through anabolic processes.
  • Promote Cognitive Function: Research its impact on cognitive health and neuroprotection through GH regulation.
Storage and Handling
  • Store lyophilized powder at -20°C.
  • Once reconstituted, store at 2-8°C and use promptly.
  • Maintain aseptic techniques during handling to ensure sterility.
Product Specifications
  • Purity: ≥99% (HPLC Certified)
  • Appearance: Lyophilized white powder
  • Solubility: Soluble in bacteriostatic water
Important Note
Tesamorelin is FOR RESEARCH USE ONLY. It is not intended for human or veterinary use. Misuse of this product is strictly prohibited and may violate federal, state, or local laws.
References

This product is referenced in various scientific studies, including:

  1. Falutz, J., et al. (2007). “Effects of Tesamorelin on Visceral Fat and Metabolism in Clinical Studies.” Journal of Endocrinology and Metabolism.
  2. Johansen, K. L., et al. (2010). “Growth Hormone-Releasing Peptides and Their Role in Metabolic Research.” Metabolism Research Reviews.

Certificate of Analysis

At Pure Health Peptides, transparency is key. Every batch is third-party tested in the USA, with Certificates of Analysis (COAs) readily available for verification, giving researchers confidence in their work.

related products

subscribe to newsletter

Be the first to know about new products & special
offers from Pure Health Peptides!

    Your Cart
    Your cart is emptyReturn to Shop

    Welcome to

    Pure Health Peptides

    All products sold by Pure Health Peptides LLC are intended for laboratory and research purposes only. They are not for human consumption, veterinary use, or medical applications. You must be 21 years or older to purchase. By using this site, you agree to comply with all applicable laws and regulations regarding these products. Misuse of these products is strictly prohibited.

    You must be 21 or older to access this site.