Product Name:

GLP-1 (C)

Chemical Information:

• Molecular Formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂
• Molecular Weight: 4409.01 g/mol
• Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
• Molecular Structure:

Description:

GLP-1 (C) is a synthetic peptide analog provided in lyophilized powder form for exclusive use in qualified laboratory environments. It is intended for in vitro systems to explore structural stability, receptor interaction modeling, and peptide pathway evaluation under controlled, non-clinical research settings.

Research Applications:

GLP-1 (C) is currently being studied in laboratory models to support:

• Structural investigation of peptide-receptor affinity
• Receptor activation modeling in non-human biological systems
• Analog characterization under simulated metabolic pathway conditions
• General evaluation of synthetic peptide behavior in assay environments

Storage and Handling:

• Store lyophilized powder at -20°C
• Once reconstituted, store at 2–8°C and use promptly
• Maintain aseptic techniques during handling to ensure sterility

Product Specifications:

• Purity: ≥99% (HPLC Verified)
• Appearance: Lyophilized white powder
• Solubility: Soluble in bacteriostatic water

Compliance Notice:

GLP-1 (C) is FOR RESEARCH USE ONLY. This product has not been evaluated by the FDA. It is not intended for human or veterinary use. This product is not approved for diagnostic, therapeutic, or clinical purposes. Misuse of this material may violate federal, state, or local laws. By purchasing this product, buyer represents and warrants that it will be used only for in vitro research purposes.